Lineage for d1kk3a3 (1kk3 A:6-200)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243198Family c.37.1.8: G proteins [52592] (31 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 243361Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (1 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83
  7. 243362Species Archaeon Pyrococcus abyssi [TaxId:29292] [75205] (5 PDB entries)
  8. 243364Domain d1kk3a3: 1kk3 A:6-200 [72642]
    Other proteins in same PDB: d1kk3a1, d1kk3a2
    complexed with gdp, mg, zn

Details for d1kk3a3

PDB Entry: 1kk3 (more details), 1.9 Å

PDB Description: Structure of the wild-type large gamma subunit of initiation factor eIF2 from Pyrococcus abyssi complexed with GDP-Mg2+

SCOP Domain Sequences for d1kk3a3:

Sequence, based on SEQRES records: (download)

>d1kk3a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi}
srqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrcpncgr
ystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqt
rehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhga
nidvlvkaiedfipt

Sequence, based on observed residues (ATOM records): (download)

>d1kk3a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi}
srqaevnigmvghvdhgkttltkaltgvwtdseelrrgitikigfadaeirrcpncgrys
tspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtre
hlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgani
dvlvkaiedfipt

SCOP Domain Coordinates for d1kk3a3:

Click to download the PDB-style file with coordinates for d1kk3a3.
(The format of our PDB-style files is described here.)

Timeline for d1kk3a3: