SCOPe 2.04: Domain d1kk3a2: 1kk3 A:322-410

Lineage for d1kk3a2 (1kk3 A:322-410)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Initiation factor eIF2 gamma subunit [74964] (3 species)

7. Species Pyrococcus abyssi [TaxId:29292] [74965] (5 PDB entries)

8. Domain d1kk3a2: 1kk3 A:322-410 [72641]
   Other proteins in same PDB: d1kk3a1, d1kk3a3
   complexed with gdp, mg, zn

Details for d1kk3a2

PDB Entry: 1kk3, 1.9 Å

PDB Description: Structure of the wild-type large gamma subunit of initiation factor eIF2 from Pyrococcus abyssi complexed with GDP-Mg2+

PDB Compounds: (A:) eIF2gamma

SCOPe Domain Sequences for d1kk3a2:

Sequence, based on SEQRES records:

>d1kk3a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Pyrococcus abyssi [TaxId: 29292]}
wdslrlevhllervvgteqelkvepikrkevlllnvgtartmglvtglgkdeievklqip
vcaepgdrvaisrqigsrwrligygiike

Sequence, based on observed residues (ATOM records):

>d1kk3a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Pyrococcus abyssi [TaxId: 29292]}
wdslrlevhllervveqelkvepikrkevlllnvgtartmglvtglgkdeievklqipvc
aepgdrvaisrqigsrwrligygiike

Timeline for d1kk3a2:

• d1kk3a2 first appeared in SCOP 1.61
  
• d1kk3a2 appears in SCOPe 2.03
  
• d1kk3a2 appears in SCOPe 2.05
  
• d1kk3a2 appears in the current release, SCOPe 2.08