Lineage for d1kk3a2 (1kk3 A:322-410)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375902Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 375903Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 375904Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins)
  6. 375946Protein Initiation factor eIF2 gamma subunit [74964] (2 species)
  7. 375949Species Archaeon Pyrococcus abyssi [TaxId:29292] [74965] (5 PDB entries)
  8. 375951Domain d1kk3a2: 1kk3 A:322-410 [72641]
    Other proteins in same PDB: d1kk3a1, d1kk3a3
    complexed with gdp, mg, zn

Details for d1kk3a2

PDB Entry: 1kk3 (more details), 1.9 Å

PDB Description: Structure of the wild-type large gamma subunit of initiation factor eIF2 from Pyrococcus abyssi complexed with GDP-Mg2+

SCOP Domain Sequences for d1kk3a2:

Sequence, based on SEQRES records: (download)

>d1kk3a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi}
wdslrlevhllervvgteqelkvepikrkevlllnvgtartmglvtglgkdeievklqip
vcaepgdrvaisrqigsrwrligygiike

Sequence, based on observed residues (ATOM records): (download)

>d1kk3a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi}
wdslrlevhllervveqelkvepikrkevlllnvgtartmglvtglgkdeievklqipvc
aepgdrvaisrqigsrwrligygiike

SCOP Domain Coordinates for d1kk3a2:

Click to download the PDB-style file with coordinates for d1kk3a2.
(The format of our PDB-style files is described here.)

Timeline for d1kk3a2: