Lineage for d1kk3a1 (1kk3 A:201-321)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167557Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 167568Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 167569Family b.43.3.1: Elongation factors [50448] (5 proteins)
  6. 167618Protein Initiation factor eIF2 gamma subunit, domain II [74962] (1 species)
  7. 167619Species Archaeon Pyrococcus abyssi [TaxId:29292] [74963] (5 PDB entries)
  8. 167621Domain d1kk3a1: 1kk3 A:201-321 [72640]
    Other proteins in same PDB: d1kk3a2, d1kk3a3

Details for d1kk3a1

PDB Entry: 1kk3 (more details), 1.9 Å

PDB Description: Structure of the wild-type large gamma subunit of initiation factor eIF2 from Pyrococcus abyssi complexed with GDP-Mg2+

SCOP Domain Sequences for d1kk3a1:

Sequence, based on SEQRES records: (download)

>d1kk3a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi}
pkrdpnkppkmlvlrsfdvnkpgtppeklvggvlggsivqgklkvgdeieirpgvpyeeh
grikyepitteivslqaggqfveeaypgglvgvgtkldpyltkgdlmagnvvgkpgklpp
v

Sequence, based on observed residues (ATOM records): (download)

>d1kk3a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi}
pkrdpnkppkmlvlrsfdvnkpgeklvggvlggsivqgklkvgdeieirpgvpyeehgri
kyepitteivslqaggqfveeaypgglvgvgtkldpyltkgdlmagnvvgkpgklppv

SCOP Domain Coordinates for d1kk3a1:

Click to download the PDB-style file with coordinates for d1kk3a1.
(The format of our PDB-style files is described here.)

Timeline for d1kk3a1: