SCOP 1.65: Domain d1kk2a2: 1kk2 A:322-410

Lineage for d1kk2a2 (1kk2 A:322-410)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.44: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50464] (1 superfamily)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins)

6. Protein Initiation factor eIF2 gamma subunit [74964] (1 species)

7. Species Archaeon Pyrococcus abyssi [TaxId:29292] [74965] (5 PDB entries)

8. Domain d1kk2a2: 1kk2 A:322-410 [72638]
   Other proteins in same PDB: d1kk2a1, d1kk2a3
   complexed with gdp, mg, zn; mutant

Details for d1kk2a2

PDB Entry: 1kk2, 2.1 Å

PDB Description: structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+

SCOP Domain Sequences for d1kk2a2:

Sequence, based on SEQRES records:

>d1kk2a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi}
wdslrlevhllervvgteqelkvepikrkevlllnvgtartmglvtglgkdeievklqip
vcaepgdrvaisrqigsrwrligygiike

Sequence, based on observed residues (ATOM records):

>d1kk2a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi}
wdslrlevhllervveqelkvepikrkevlllnvgtartmglvtglgkdeievklqipvc
aepgdrvaisrqigsrwrligygiike

Timeline for d1kk2a2:

• d1kk2a2 first appeared in SCOP 1.61
  
• d1kk2a2 appears in SCOP 1.63
  
• d1kk2a2 appears in SCOP 1.67
  
• d1kk2a2 appears in the current release, SCOPe 2.08