Lineage for d1kk2a1 (1kk2 A:201-321)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298343Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 298354Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 298355Family b.43.3.1: Elongation factors [50448] (6 proteins)
  6. 298409Protein Initiation factor eIF2 gamma subunit, domain II [74962] (1 species)
  7. 298410Species Archaeon Pyrococcus abyssi [TaxId:29292] [74963] (5 PDB entries)
  8. 298415Domain d1kk2a1: 1kk2 A:201-321 [72637]
    Other proteins in same PDB: d1kk2a2, d1kk2a3
    complexed with gdp, mg, zn; mutant

Details for d1kk2a1

PDB Entry: 1kk2 (more details), 2.1 Å

PDB Description: structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+

SCOP Domain Sequences for d1kk2a1:

Sequence, based on SEQRES records: (download)

>d1kk2a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi}
pkrdpnkppkmlvlrsfdvnkpgtppeklvggvldgsivqgklkvgdeieirpgvpyeeh
grikyepitteivslqaggqfveeaypgglvgvgtkldpyltkgdlmagnvvgkpgklpp
v

Sequence, based on observed residues (ATOM records): (download)

>d1kk2a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi}
pkrdpnkppkmlvlrsfdvnkpglvggvldgsivqgklkvgdeieirpgvpyeehgriky
epitteivslqaggqfveeaypgglvgvgtkldpyltkgdlmagnvvgkpgklppv

SCOP Domain Coordinates for d1kk2a1:

Click to download the PDB-style file with coordinates for d1kk2a1.
(The format of our PDB-style files is described here.)

Timeline for d1kk2a1: