SCOP 1.67: Domain d1kk1a3: 1kk1 A:6-200

Lineage for d1kk1a3 (1kk1 A:6-200)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (37 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (2 species)
   includes rubredoxin-like zinc finger insert domain, res. 56-83

7. Species Archaeon Pyrococcus abyssi [TaxId:29292] [75205] (5 PDB entries)

8. Domain d1kk1a3: 1kk1 A:6-200 [72636]
   Other proteins in same PDB: d1kk1a1, d1kk1a2
   complexed with gnp, mg, zn; mutant

Details for d1kk1a3

PDB Entry: 1kk1, 1.8 Å

PDB Description: structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdpnp-mg2+

SCOP Domain Sequences for d1kk1a3:

Sequence, based on SEQRES records:

>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi}
srqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrcpncgr
ystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqt
rehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhga
nidvlvkaiedfipt

Sequence, based on observed residues (ATOM records):

>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi}
srqaevnigmvghvdhgkttltkaltgvwtdseelrrgitikigfadaeirrcpncgrys
tspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtre
hlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgani
dvlvkaiedfipt

Timeline for d1kk1a3:

• d1kk1a3 first appeared in SCOP 1.61
  
• d1kk1a3 appears in SCOP 1.65
  
• d1kk1a3 appears in SCOP 1.69
  
• d1kk1a3 appears in the current release, SCOPe 2.08