Lineage for d1kk1a3 (1kk1 A:6-200)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 393949Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (2 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83
  7. 393952Species Archaeon Pyrococcus abyssi [TaxId:29292] [75205] (5 PDB entries)
  8. 393953Domain d1kk1a3: 1kk1 A:6-200 [72636]
    Other proteins in same PDB: d1kk1a1, d1kk1a2
    complexed with gnp, mg, zn; mutant

Details for d1kk1a3

PDB Entry: 1kk1 (more details), 1.8 Å

PDB Description: structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdpnp-mg2+

SCOP Domain Sequences for d1kk1a3:

Sequence, based on SEQRES records: (download)

>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi}
srqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrcpncgr
ystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqt
rehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhga
nidvlvkaiedfipt

Sequence, based on observed residues (ATOM records): (download)

>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi}
srqaevnigmvghvdhgkttltkaltgvwtdseelrrgitikigfadaeirrcpncgrys
tspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtre
hlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgani
dvlvkaiedfipt

SCOP Domain Coordinates for d1kk1a3:

Click to download the PDB-style file with coordinates for d1kk1a3.
(The format of our PDB-style files is described here.)

Timeline for d1kk1a3: