Class b: All beta proteins [48724] (178 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
Protein Initiation factor eIF2 gamma subunit [74964] (3 species) |
Species Pyrococcus abyssi [TaxId:29292] [74965] (5 PDB entries) |
Domain d1kk1a2: 1kk1 A:322-410 [72635] Other proteins in same PDB: d1kk1a1, d1kk1a3 complexed with gnp, mg, zn; mutant |
PDB Entry: 1kk1 (more details), 1.8 Å
SCOPe Domain Sequences for d1kk1a2:
Sequence, based on SEQRES records: (download)
>d1kk1a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Pyrococcus abyssi [TaxId: 29292]} wdslrlevhllervvgteqelkvepikrkevlllnvgtartmglvtglgkdeievklqip vcaepgdrvaisrqigsrwrligygiike
>d1kk1a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Pyrococcus abyssi [TaxId: 29292]} wdslrlevhllervveqelkvepikrkevlllnvgtartmglvtglgkdeievklqipvc aepgdrvaisrqigsrwrligygiike
Timeline for d1kk1a2: