Lineage for d1kk1a1 (1kk1 A:201-321)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375649Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 375660Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 375661Family b.43.3.1: Elongation factors [50448] (6 proteins)
  6. 375717Protein Initiation factor eIF2 gamma subunit, domain II [74962] (2 species)
  7. 375720Species Archaeon Pyrococcus abyssi [TaxId:29292] [74963] (5 PDB entries)
  8. 375721Domain d1kk1a1: 1kk1 A:201-321 [72634]
    Other proteins in same PDB: d1kk1a2, d1kk1a3
    complexed with gnp, mg, zn; mutant

Details for d1kk1a1

PDB Entry: 1kk1 (more details), 1.8 Å

PDB Description: structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdpnp-mg2+

SCOP Domain Sequences for d1kk1a1:

Sequence, based on SEQRES records: (download)

>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi}
pkrdpnkppkmlvlrsfdvnkpgtppeklvggvldgsivqgklkvgdeieirpgvpyeeh
grikyepitteivslqaggqfveeaypgglvgvgtkldpyltkgdlmagnvvgkpgklpp
v

Sequence, based on observed residues (ATOM records): (download)

>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi}
pkrdpnkppkmlvlrsfdvnkpgklvggvldgsivqgklkvgdeieirpgvpyeehgrik
yepitteivslqaggqfveeaypgglvgvgtkldpyltkgdlmagnvvgkpgklppv

SCOP Domain Coordinates for d1kk1a1:

Click to download the PDB-style file with coordinates for d1kk1a1.
(The format of our PDB-style files is described here.)

Timeline for d1kk1a1: