Lineage for d1kk0a1 (1kk0 A:201-321)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317091Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317134Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1317135Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1317275Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)
  7. 1317278Species Pyrococcus abyssi [TaxId:29292] [74963] (5 PDB entries)
  8. 1317282Domain d1kk0a1: 1kk0 A:201-321 [72631]
    Other proteins in same PDB: d1kk0a2, d1kk0a3
    complexed with zn

Details for d1kk0a1

PDB Entry: 1kk0 (more details), 1.95 Å

PDB Description: Structure of the large gamma subunit of initiation factor eIF2 from Pyrococcus abyssi
PDB Compounds: (A:) eIF2gamma

SCOPe Domain Sequences for d1kk0a1:

Sequence, based on SEQRES records: (download)

>d1kk0a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Pyrococcus abyssi [TaxId: 29292]}
pkrdpnkppkmlvlrsfdvnkpgtppeklvggvlggsivqgklkvgdeieirpgvpyeeh
grikyepitteivslqaggqfveeaypgglvgvgtkldpyltkgdlmagnvvgkpgklpp
v

Sequence, based on observed residues (ATOM records): (download)

>d1kk0a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Pyrococcus abyssi [TaxId: 29292]}
pkrdpnkppkmlvlrsfdvnkpglvggvlggsivqgklkvgdeieirpgvpyeehgriky
epitteivslqaggqfveeaypgglvgvgtkldpyltkgdlmagnvvgkpgklppv

SCOPe Domain Coordinates for d1kk0a1:

Click to download the PDB-style file with coordinates for d1kk0a1.
(The format of our PDB-style files is described here.)

Timeline for d1kk0a1: