Lineage for d1kjza3 (1kjz A:6-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867269Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)
  7. 2867272Species Pyrococcus abyssi [TaxId:29292] [75205] (5 PDB entries)
  8. 2867275Domain d1kjza3: 1kjz A:6-200 [72630]
    Other proteins in same PDB: d1kjza1, d1kjza2
    complexed with zn; mutant

Details for d1kjza3

PDB Entry: 1kjz (more details), 1.85 Å

PDB Description: structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant
PDB Compounds: (A:) eIF2gamma

SCOPe Domain Sequences for d1kjza3:

Sequence, based on SEQRES records: (download)

>d1kjza3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Pyrococcus abyssi [TaxId: 29292]}
srqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrcpncgr
ystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqt
rehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhga
nidvlvkaiedfipt

Sequence, based on observed residues (ATOM records): (download)

>d1kjza3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Pyrococcus abyssi [TaxId: 29292]}
srqaevnigmvghvdhgkttltkaltgvwtdhseelrrgitikigfadaeirrcpncgry
stspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtr
ehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgan
idvlvkaiedfipt

SCOPe Domain Coordinates for d1kjza3:

Click to download the PDB-style file with coordinates for d1kjza3.
(The format of our PDB-style files is described here.)

Timeline for d1kjza3: