SCOP 1.71: Domain d1kjza2: 1kjz A:322-410

Lineage for d1kjza2 (1kjz A:322-410)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (5 proteins)

6. Protein Initiation factor eIF2 gamma subunit [74964] (2 species)

7. Species Archaeon Pyrococcus abyssi [TaxId:29292] [74965] (5 PDB entries)

8. Domain d1kjza2: 1kjz A:322-410 [72629]
   Other proteins in same PDB: d1kjza1, d1kjza3
   complexed with zn; mutant

Details for d1kjza2

PDB Entry: 1kjz, 1.85 Å

PDB Description: structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant

SCOP Domain Sequences for d1kjza2:

Sequence; same for both SEQRES and ATOM records:

>d1kjza2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi}
wdslrlevhllervvgteqelkvepikrkevlllnvgtartmglvtglgkdeievklqip
vcaepgdrvaisrqigsrwrligygiike

Timeline for d1kjza2:

• d1kjza2 first appeared in SCOP 1.61
  
• d1kjza2 appears in SCOP 1.69
  
• d1kjza2 appears in SCOP 1.73
  
• d1kjza2 appears in the current release, SCOPe 2.08