| Class b: All beta proteins [48724] (141 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins) |
| Protein Initiation factor eIF2 gamma subunit [74964] (2 species) |
| Species Archaeon Pyrococcus abyssi [TaxId:29292] [74965] (5 PDB entries) |
| Domain d1kjza2: 1kjz A:322-410 [72629] Other proteins in same PDB: d1kjza1, d1kjza3 complexed with zn; mutant |
PDB Entry: 1kjz (more details), 1.85 Å
SCOP Domain Sequences for d1kjza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjza2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi}
wdslrlevhllervvgteqelkvepikrkevlllnvgtartmglvtglgkdeievklqip
vcaepgdrvaisrqigsrwrligygiike
Timeline for d1kjza2: