Lineage for d1kjza2 (1kjz A:322-410)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298577Fold b.44: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50464] (1 superfamily)
    barrel, closed; n=6, S=10; greek-key
  4. 298578Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 298579Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins)
  6. 298621Protein Initiation factor eIF2 gamma subunit [74964] (1 species)
  7. 298622Species Archaeon Pyrococcus abyssi [TaxId:29292] [74965] (5 PDB entries)
  8. 298625Domain d1kjza2: 1kjz A:322-410 [72629]
    Other proteins in same PDB: d1kjza1, d1kjza3
    complexed with zn; mutant

Details for d1kjza2

PDB Entry: 1kjz (more details), 1.85 Å

PDB Description: structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant

SCOP Domain Sequences for d1kjza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjza2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi}
wdslrlevhllervvgteqelkvepikrkevlllnvgtartmglvtglgkdeievklqip
vcaepgdrvaisrqigsrwrligygiike

SCOP Domain Coordinates for d1kjza2:

Click to download the PDB-style file with coordinates for d1kjza2.
(The format of our PDB-style files is described here.)

Timeline for d1kjza2: