Lineage for d1kj7b_ (1kj7 B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168884Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 168885Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 168886Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 168902Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 168903Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (141 PDB entries)
  8. 169102Domain d1kj7b_: 1kj7 B: [72582]

Details for d1kj7b_

PDB Entry: 1kj7 (more details), 2 Å

PDB Description: substrate shape determines specificity of recognition recognition for hiv-1 protease: analysis of crystal structures of six substrate complexes

SCOP Domain Sequences for d1kj7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj7b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

SCOP Domain Coordinates for d1kj7b_:

Click to download the PDB-style file with coordinates for d1kj7b_.
(The format of our PDB-style files is described here.)

Timeline for d1kj7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kj7a_