Lineage for d1kj3i1 (1kj3 I:182-278)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026191Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2026491Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
    Uniprot P01901 22-299
  8. 2026555Domain d1kj3i1: 1kj3 I:182-278 [72571]
    Other proteins in same PDB: d1kj3h2, d1kj3h3, d1kj3i2, d1kj3l_, d1kj3m_

Details for d1kj3i1

PDB Entry: 1kj3 (more details), 2.3 Å

PDB Description: Mhc Class I H-2Kb molecule complexed with pKB1 peptide
PDB Compounds: (I:) h-2kb MHC class I molecule alpha chain

SCOPe Domain Sequences for d1kj3i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj3i1 b.1.1.2 (I:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

SCOPe Domain Coordinates for d1kj3i1:

Click to download the PDB-style file with coordinates for d1kj3i1.
(The format of our PDB-style files is described here.)

Timeline for d1kj3i1: