Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries) |
Domain d1kj3i1: 1kj3 I:182-278 [72571] Other proteins in same PDB: d1kj3h2, d1kj3i2, d1kj3l_, d1kj3m_ |
PDB Entry: 1kj3 (more details), 2.3 Å
SCOP Domain Sequences for d1kj3i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kj3i1 b.1.1.2 (I:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrweppp
Timeline for d1kj3i1:
View in 3D Domains from other chains: (mouse over for more information) d1kj3h1, d1kj3h2, d1kj3l_, d1kj3m_ |