Lineage for d1kj2m_ (1kj2 M:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 452578Protein beta2-microglobulin [88600] (4 species)
  7. 452709Species Mouse (Mus musculus) [TaxId:10090] [88603] (60 PDB entries)
  8. 452764Domain d1kj2m_: 1kj2 M: [72568]
    Other proteins in same PDB: d1kj2a_, d1kj2b_, d1kj2d_, d1kj2e_, d1kj2h1, d1kj2h2, d1kj2i1, d1kj2i2

Details for d1kj2m_

PDB Entry: 1kj2 (more details), 2.71 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1kj2m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj2m_ b.1.1.2 (M:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1kj2m_:

Click to download the PDB-style file with coordinates for d1kj2m_.
(The format of our PDB-style files is described here.)

Timeline for d1kj2m_: