SCOPe 2.05: Domain d1kj2i1: 1kj2 I:182-277

Lineage for d1kj2i1 (1kj2 I:182-277)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
   Uniprot P01901 22-299

8. Domain d1kj2i1: 1kj2 I:182-277 [72565]
   Other proteins in same PDB: d1kj2a_, d1kj2b_, d1kj2d_, d1kj2e_, d1kj2h2, d1kj2i2, d1kj2l_, d1kj2m_
   complexed with nag

Details for d1kj2i1

PDB Entry: 1kj2, 2.71 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

PDB Compounds: (I:) Allogeneic H-2Kb MHC Class I Molecule

SCOPe Domain Sequences for d1kj2i1:

Sequence; same for both SEQRES and ATOM records:

>d1kj2i1 b.1.1.2 (I:182-277) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwepp

Timeline for d1kj2i1:

• d1kj2i1 first appeared in SCOP 1.61
  
• d1kj2i1 appears in SCOPe 2.04
  
• d1kj2i1 appears in SCOPe 2.06
  
• d1kj2i1 appears in the current release, SCOPe 2.08