SCOP 1.63: Domain d1kj2i1: 1kj2 I:182-277

Lineage for d1kj2i1 (1kj2 I:182-277)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries)

8. Domain d1kj2i1: 1kj2 I:182-277 [72565]
   Other proteins in same PDB: d1kj2a_, d1kj2b_, d1kj2d_, d1kj2e_, d1kj2h2, d1kj2i2
   complexed with gal, man, nag, sia

Details for d1kj2i1

PDB Entry: 1kj2, 2.71 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1kj2i1:

Sequence; same for both SEQRES and ATOM records:

>d1kj2i1 b.1.1.2 (I:182-277) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwepp

Timeline for d1kj2i1:

• d1kj2i1 first appeared in SCOP 1.61
  
• d1kj2i1 appears in SCOP 1.65
  
• d1kj2i1 appears in the current release, SCOPe 2.08