Lineage for d1kj2d_ (1kj2 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757747Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1757852Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)
  8. 1757873Domain d1kj2d_: 1kj2 D: [72561]
    Other proteins in same PDB: d1kj2h1, d1kj2h2, d1kj2i1, d1kj2i2, d1kj2l_, d1kj2m_
    complexed with nag

Details for d1kj2d_

PDB Entry: 1kj2 (more details), 2.71 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex
PDB Compounds: (D:) KB5-C20 T-Cell receptor alpha-chain

SCOPe Domain Sequences for d1kj2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kj2d_ b.1.1.1 (D:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qqvrqspqsltvwegetailncsyedstfnyfpwyqqfpgegpallisirsvsdkkedgr
ftiffnkrekklslhitdsqpgdsatyfcaaryqggralifgtgttvsvsp

SCOPe Domain Coordinates for d1kj2d_:

Click to download the PDB-style file with coordinates for d1kj2d_.
(The format of our PDB-style files is described here.)

Timeline for d1kj2d_: