Lineage for d1kilb_ (1kil B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266412Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2266413Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2266482Protein Syntaxin 1A [88908] (3 species)
  7. 2266489Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
    Uniprot P32851 196-259
    a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B
  8. 2266496Domain d1kilb_: 1kil B: [72519]
    Other proteins in same PDB: d1kila_, d1kilc_, d1kild_, d1kile_
    complex with SNAP25, synaptobrevin and complexin fragments
    complexed with mg

Details for d1kilb_

PDB Entry: 1kil (more details), 2.3 Å

PDB Description: Three-dimensional structure of the complexin/SNARE complex
PDB Compounds: (B:) Syntaxin SNARE motif short

SCOPe Domain Sequences for d1kilb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kilb_ h.1.15.1 (B:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd

SCOPe Domain Coordinates for d1kilb_:

Click to download the PDB-style file with coordinates for d1kilb_.
(The format of our PDB-style files is described here.)

Timeline for d1kilb_: