Lineage for d1kilb_ (1kil B:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345390Superfamily h.1.15: SNARE fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 345391Family h.1.15.1: SNARE fusion complex [58039] (10 proteins)
  6. 345431Protein Syntaxin 1A [88908] (2 species)
  7. 345434Species Rat (Rattus norvegicus) [TaxId:10116] [88909] (5 PDB entries)
    a globular structure of a larger fragment containing this region is available; (1dn1), chain B or (d1dn1b_)_
  8. 345445Domain d1kilb_: 1kil B: [72519]
    Other proteins in same PDB: d1kila_, d1kilc_, d1kild_, d1kile_
    complex with SNAP25, synaptobrevin and complexin fragments

Details for d1kilb_

PDB Entry: 1kil (more details), 2.3 Å

PDB Description: Three-dimensional structure of the complexin/SNARE complex

SCOP Domain Sequences for d1kilb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kilb_ h.1.15.1 (B:) Syntaxin 1A {Rat (Rattus norvegicus)}
lseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd

SCOP Domain Coordinates for d1kilb_:

Click to download the PDB-style file with coordinates for d1kilb_.
(The format of our PDB-style files is described here.)

Timeline for d1kilb_: