SCOP 1.65: Domain d1kila_: 1kil A:

Lineage for d1kila_ (1kil A:)

1. Root: SCOP 1.65

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (1 family)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (10 proteins)

6. Protein Synaptobrevin [88903] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88904] (3 PDB entries)

8. Domain d1kila_: 1kil A: [72518]
   Other proteins in same PDB: d1kilb_, d1kilc_, d1kild_, d1kile_
   complex with SNAP25, syntaxin and complexin fragments

Details for d1kila_

PDB Entry: 1kil, 2.3 Å

PDB Description: Three-dimensional structure of the complexin/SNARE complex

SCOP Domain Sequences for d1kila_:

Sequence; same for both SEQRES and ATOM records:

>d1kila_ h.1.15.1 (A:) Synaptobrevin {Rat (Rattus norvegicus)}
snrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkrk
ywwkn

Timeline for d1kila_:

• d1kila_ first appeared in SCOP 1.61
  
• d1kila_ appears in SCOP 1.63
  
• d1kila_ appears in SCOP 1.67
  
• d1kila_ appears in the current release, SCOPe 2.08