Lineage for d1kila_ (1kil A:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591003Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2591004Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2591017Protein Synaptobrevin [88903] (3 species)
  7. 2591024Species Norway rat (Rattus norvegicus) [TaxId:10116] [88904] (4 PDB entries)
  8. 2591026Domain d1kila_: 1kil A: [72518]
    Other proteins in same PDB: d1kilb_, d1kilc_, d1kild_, d1kile_
    complex with SNAP25, syntaxin and complexin fragments
    complexed with mg

Details for d1kila_

PDB Entry: 1kil (more details), 2.3 Å

PDB Description: Three-dimensional structure of the complexin/SNARE complex
PDB Compounds: (A:) Synaptobrevin SNARE motif

SCOPe Domain Sequences for d1kila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kila_ h.1.15.1 (A:) Synaptobrevin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkrk
ywwkn

SCOPe Domain Coordinates for d1kila_:

Click to download the PDB-style file with coordinates for d1kila_.
(The format of our PDB-style files is described here.)

Timeline for d1kila_: