Lineage for d1kija1 (1kij A:221-392)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598290Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 598291Protein DNA gyrase B [54227] (2 species)
  7. 598295Species Thermus thermophilus [TaxId:274] [75352] (1 PDB entry)
  8. 598296Domain d1kija1: 1kij A:221-392 [72514]
    Other proteins in same PDB: d1kija2, d1kijb2

Details for d1kija1

PDB Entry: 1kij (more details), 2.3 Å

PDB Description: crystal structure of the 43k atpase domain of thermus thermophilus gyrase b in complex with novobiocin

SCOP Domain Sequences for d1kija1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kija1 d.14.1.3 (A:221-392) DNA gyrase B {Thermus thermophilus}
gvasfakalaegedllyekpflirgthgevevevgflhtqgynaeiltyanmiptrdggt
hltafksaysralnqyakkaglnkekgpqptgddlleglyavvsvklpnpqfegqtkgkl
lnpeagtavgqvvyerlleileenpriakavyekalraaqareaarkarelv

SCOP Domain Coordinates for d1kija1:

Click to download the PDB-style file with coordinates for d1kija1.
(The format of our PDB-style files is described here.)

Timeline for d1kija1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kija2