Lineage for d1kibg_ (1kib G:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 904839Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)
  7. 904840Species Arthrospira maxima [TaxId:129910] [63457] (2 PDB entries)
  8. 904848Domain d1kibg_: 1kib G: [72508]
    complexed with hem

Details for d1kibg_

PDB Entry: 1kib (more details), 3.5 Å

PDB Description: cytochrome c6 from arthrospira maxima: an assembly of 24 subunits in the form of an oblate shell
PDB Compounds: (G:) cytochrome c6

SCOPe Domain Sequences for d1kibg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kibg_ a.3.1.1 (G:) Cytochrome c6 (synonym: cytochrome c553) {Arthrospira maxima [TaxId: 129910]}
gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
ampgfngrlspkqiedvaayvvdqaekgw

SCOPe Domain Coordinates for d1kibg_:

Click to download the PDB-style file with coordinates for d1kibg_.
(The format of our PDB-style files is described here.)

Timeline for d1kibg_: