Lineage for d1kibe_ (1kib E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304440Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)
  7. 2304441Species Arthrospira maxima [TaxId:129910] [63457] (2 PDB entries)
  8. 2304446Domain d1kibe_: 1kib E: [72506]
    complexed with hem

Details for d1kibe_

PDB Entry: 1kib (more details), 3.5 Å

PDB Description: cytochrome c6 from arthrospira maxima: an assembly of 24 subunits in the form of an oblate shell
PDB Compounds: (E:) cytochrome c6

SCOPe Domain Sequences for d1kibe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kibe_ a.3.1.1 (E:) Cytochrome c6 (synonym: cytochrome c553) {Arthrospira maxima [TaxId: 129910]}
gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
ampgfngrlspkqiedvaayvvdqaekgw

SCOPe Domain Coordinates for d1kibe_:

Click to download the PDB-style file with coordinates for d1kibe_.
(The format of our PDB-style files is described here.)

Timeline for d1kibe_: