| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein CDC42 [52619] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52620] (18 PDB entries) |
| Domain d1ki1a_: 1ki1 A: [72496] Other proteins in same PDB: d1ki1b1, d1ki1b2, d1ki1d1, d1ki1d2 |
PDB Entry: 1ki1 (more details), 2.3 Å
SCOP Domain Sequences for d1ki1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ki1a_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
Timeline for d1ki1a_: