Lineage for d1kgya_ (1kgy A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554850Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 554851Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) (S)
  5. 554894Family b.18.1.4: Ligand-binding domain of the ephb2 receptor tyrosine kinase [49800] (1 protein)
  6. 554895Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)
  7. 554896Species Mouse (Mus musculus) [TaxId:10090] [49802] (3 PDB entries)
  8. 554898Domain d1kgya_: 1kgy A: [72449]
    Other proteins in same PDB: d1kgye_, d1kgyf_, d1kgyg_, d1kgyh_

Details for d1kgya_

PDB Entry: 1kgy (more details), 2.7 Å

PDB Description: crystal structure of the ephb2-ephrinb2 complex

SCOP Domain Sequences for d1kgya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgya_ b.18.1.4 (A:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus)}
aeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi
rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv
dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp
r

SCOP Domain Coordinates for d1kgya_:

Click to download the PDB-style file with coordinates for d1kgya_.
(The format of our PDB-style files is described here.)

Timeline for d1kgya_: