Lineage for d1kg0c_ (1kg0 C:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336759Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 336760Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 336761Family d.169.1.1: C-type lectin domain [56437] (21 proteins)
  6. 336801Protein EBV gp42 [75583] (1 species)
  7. 336802Species Epstein-Barr virus [TaxId:10376] [75584] (1 PDB entry)
  8. 336803Domain d1kg0c_: 1kg0 C: [72445]
    Other proteins in same PDB: d1kg0a1, d1kg0a2, d1kg0b1, d1kg0b2

Details for d1kg0c_

PDB Entry: 1kg0 (more details), 2.65 Å

PDB Description: structure of the epstein-barr virus gp42 protein bound to the mhc class ii receptor hla-dr1

SCOP Domain Sequences for d1kg0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kg0c_ d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus}
htfqvpqnytkanctycntreytfsykgccfyftkkkhtwngcfqacaekypctyfygpt
pdilpvvtrnlnaieslwvgvyrvgegnwtsldggtfkvyqifgshctyvskfstvpvsh
hecsflkpclcvsqrs

SCOP Domain Coordinates for d1kg0c_:

Click to download the PDB-style file with coordinates for d1kg0c_.
(The format of our PDB-style files is described here.)

Timeline for d1kg0c_: