Lineage for d1kg0b2 (1kg0 B:3-92)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021417Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1021427Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)
  8. 1021438Domain d1kg0b2: 1kg0 B:3-92 [72444]
    Other proteins in same PDB: d1kg0a1, d1kg0a2, d1kg0b1, d1kg0c_

Details for d1kg0b2

PDB Entry: 1kg0 (more details), 2.65 Å

PDB Description: structure of the epstein-barr virus gp42 protein bound to the mhc class ii receptor hla-dr1
PDB Compounds: (B:) MHC class II Receptor HLA-DR1

SCOPe Domain Sequences for d1kg0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kg0b2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1kg0b2:

Click to download the PDB-style file with coordinates for d1kg0b2.
(The format of our PDB-style files is described here.)

Timeline for d1kg0b2: