Lineage for d1kg0b2 (1kg0 B:3-92)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190467Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 190474Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (9 PDB entries)
  8. 190502Domain d1kg0b2: 1kg0 B:3-92 [72444]
    Other proteins in same PDB: d1kg0a1, d1kg0b1, d1kg0c_

Details for d1kg0b2

PDB Entry: 1kg0 (more details), 2.65 Å

PDB Description: structure of the epstein-barr virus gp42 protein bound to the mhc class ii receptor hla-dr1

SCOP Domain Sequences for d1kg0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kg0b2 d.19.1.1 (B:3-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1kg0b2:

Click to download the PDB-style file with coordinates for d1kg0b2.
(The format of our PDB-style files is described here.)

Timeline for d1kg0b2: