Lineage for d1kg0b1 (1kg0 B:93-190)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107193Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1107201Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 1107232Domain d1kg0b1: 1kg0 B:93-190 [72443]
    Other proteins in same PDB: d1kg0a1, d1kg0a2, d1kg0b2, d1kg0c_

Details for d1kg0b1

PDB Entry: 1kg0 (more details), 2.65 Å

PDB Description: structure of the epstein-barr virus gp42 protein bound to the mhc class ii receptor hla-dr1
PDB Compounds: (B:) MHC class II Receptor HLA-DR1

SCOPe Domain Sequences for d1kg0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kg0b1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d1kg0b1:

Click to download the PDB-style file with coordinates for d1kg0b1.
(The format of our PDB-style files is described here.)

Timeline for d1kg0b1: