SCOP 1.61: Domain d1kg0b1: 1kg0 B:93-190

Lineage for d1kg0b1 (1kg0 B:93-190)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (9 PDB entries)

8. Domain d1kg0b1: 1kg0 B:93-190 [72443]
   Other proteins in same PDB: d1kg0a2, d1kg0b2, d1kg0c_

Details for d1kg0b1

PDB Entry: 1kg0, 2.65 Å

PDB Description: structure of the epstein-barr virus gp42 protein bound to the mhc class ii receptor hla-dr1

SCOP Domain Sequences for d1kg0b1:

Sequence; same for both SEQRES and ATOM records:

>d1kg0b1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Timeline for d1kg0b1:

• d1kg0b1 is new in SCOP 1.61
  
• d1kg0b1 appears in SCOP 1.63
  
• d1kg0b1 appears in the current release, SCOPe 2.08