Lineage for d1kfyb2 (1kfy B:1-105)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934046Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species)
  7. 2934050Species Escherichia coli [TaxId:562] [54326] (6 PDB entries)
  8. 2934057Domain d1kfyb2: 1kfy B:1-105 [72431]
    Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb1, d1kfyc_, d1kfyd_, d1kfym1, d1kfym2, d1kfym3, d1kfyn1, d1kfyo_, d1kfyp_
    complexed with brs, ce1, f3s, fad, fes, oaa, sf4

Details for d1kfyb2

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol
PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1kfyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfyb2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

SCOPe Domain Coordinates for d1kfyb2:

Click to download the PDB-style file with coordinates for d1kfyb2.
(The format of our PDB-style files is described here.)

Timeline for d1kfyb2: