Lineage for d1kfya2 (1kfy A:0-225,A:358-442)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176345Family c.3.1.4: Succinate dehydrogenase/fumarate reductase N-terminal domain [51934] (4 proteins)
  6. 176374Protein Fumarate reductase flavoprotein subunit [51937] (2 species)
  7. 176375Species Escherichia coli [TaxId:562] [51938] (3 PDB entries)
  8. 176380Domain d1kfya2: 1kfy A:0-225,A:358-442 [72428]
    Other proteins in same PDB: d1kfya1, d1kfya3, d1kfyb1, d1kfyb2, d1kfyc_, d1kfyd_, d1kfym1, d1kfym3, d1kfyn1, d1kfyn2, d1kfyo_, d1kfyp_

Details for d1kfya2

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol

SCOP Domain Sequences for d1kfya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfya2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase flavoprotein subunit {Escherichia coli}
mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdXmggietdqncetr
ikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagngneaaieaqaa
gveqrlkdlvnq

SCOP Domain Coordinates for d1kfya2:

Click to download the PDB-style file with coordinates for d1kfya2.
(The format of our PDB-style files is described here.)

Timeline for d1kfya2: