Lineage for d1kfva_ (1kfv A:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 201031Fold e.14: DNA repair protein MutM (Fpg) [56735] (1 superfamily)
  4. 201032Superfamily e.14.1: DNA repair protein MutM (Fpg) [56736] (1 family) (S)
  5. 201033Family e.14.1.1: DNA repair protein MutM (Fpg) [56737] (1 protein)
  6. 201034Protein DNA repair protein MutM (Fpg) [56738] (2 species)
  7. 201035Species Escherichia coli [TaxId:562] [75611] (2 PDB entries)
  8. 201040Domain d1kfva_: 1kfv A: [72425]

Details for d1kfva_

PDB Entry: 1kfv (more details), 2.55 Å

PDB Description: Crystal Structure of Lactococcus lactis Formamido-pyrimidine DNA Glycosylase (alias Fpg or MutM) Non Covalently Bound to an AP Site Containing DNA.

SCOP Domain Sequences for d1kfva_:

Sequence, based on SEQRES records: (download)

>d1kfva_ e.14.1.1 (A:) DNA repair protein MutM (Fpg) {Escherichia coli}
gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
akihpeketnqliessihllhdsiieilqkaiklggssirtysalgstgkmqnelqvygk
tgekcsrcgaeiqkikvagrgthfcpvcqqk

Sequence, based on observed residues (ATOM records): (download)

>d1kfva_ e.14.1.1 (A:) DNA repair protein MutM (Fpg) {Escherichia coli}
gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
akihpeketnqliessihllhdsiieilqkaiklggssistgkmqnelqvygktgekcsr
cgaeiqkikvagrgthfcpvcqqk

SCOP Domain Coordinates for d1kfva_:

Click to download the PDB-style file with coordinates for d1kfva_.
(The format of our PDB-style files is described here.)

Timeline for d1kfva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kfvb_