Lineage for d1kfle1 (1kfl E:2-350)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2097923Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 2097924Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)
  7. 2097976Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (4 PDB entries)
  8. 2097993Domain d1kfle1: 1kfl E:2-350 [72417]
    Other proteins in same PDB: d1kfla2, d1kflb2, d1kflc2, d1kfld2, d1kfle2, d1kflf2, d1kflg2, d1kflh2
    complexed with mn, pep, phe, so4

Details for d1kfle1

PDB Entry: 1kfl (more details), 2.8 Å

PDB Description: Crystal structure of phenylalanine-regulated 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from E.coli complexed with Mn2+, PEP, and Phe
PDB Compounds: (E:) 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase

SCOPe Domain Sequences for d1kfle1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfle1 c.1.10.4 (E:2-350) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme [TaxId: 562]}
nyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpc
sihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqind
glriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglsc
pvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepny
sakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmv
eshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg

SCOPe Domain Coordinates for d1kfle1:

Click to download the PDB-style file with coordinates for d1kfle1.
(The format of our PDB-style files is described here.)

Timeline for d1kfle1: