Lineage for d1kf6n1 (1kf6 N:106-243)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 149177Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
  5. 149178Family a.1.2.1: Fumarate reductase iron-sulfur protein, C-terminal domain [46549] (1 protein)
  6. 149179Protein Fumarate reductase iron-sulfur protein, C-terminal domain [46550] (2 species)
  7. 149180Species Escherichia coli [TaxId:562] [46551] (3 PDB entries)
  8. 149182Domain d1kf6n1: 1kf6 N:106-243 [72404]
    Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b2, d1kf6c_, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n2, d1kf6o_, d1kf6p_

Details for d1kf6n1

PDB Entry: 1kf6 (more details), 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO

SCOP Domain Sequences for d1kf6n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf6n1 a.1.2.1 (N:106-243) Fumarate reductase iron-sulfur protein, C-terminal domain {Escherichia coli}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOP Domain Coordinates for d1kf6n1:

Click to download the PDB-style file with coordinates for d1kf6n1.
(The format of our PDB-style files is described here.)

Timeline for d1kf6n1: