Lineage for d1kf6c_ (1kf6 C:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201945Family f.2.1.9: Fumarate reductase respiratory complex transmembrane subunits [56910] (1 protein)
  6. 201946Protein Fumarate reductase respiratory complex transmembrane subunits [56911] (2 species)
  7. 201947Species Escherichia coli [TaxId:562] [56912] (3 PDB entries)
  8. 201948Domain d1kf6c_: 1kf6 C: [72399]
    Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b1, d1kf6b2, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n1, d1kf6n2

Details for d1kf6c_

PDB Entry: 1kf6 (more details), 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO

SCOP Domain Sequences for d1kf6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf6c_ f.2.1.9 (C:) Fumarate reductase respiratory complex transmembrane subunits {Escherichia coli}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

SCOP Domain Coordinates for d1kf6c_:

Click to download the PDB-style file with coordinates for d1kf6c_.
(The format of our PDB-style files is described here.)

Timeline for d1kf6c_: