Lineage for d1kf6b2 (1kf6 B:1-105)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854217Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 854326Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
  6. 854369Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (2 species)
  7. 854370Species Escherichia coli [TaxId:562] [54326] (5 PDB entries)
  8. 854371Domain d1kf6b2: 1kf6 B:1-105 [72398]
    Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b1, d1kf6c_, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n1, d1kf6o_, d1kf6p_

Details for d1kf6b2

PDB Entry: 1kf6 (more details), 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO
PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOP Domain Sequences for d1kf6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

SCOP Domain Coordinates for d1kf6b2:

Click to download the PDB-style file with coordinates for d1kf6b2.
(The format of our PDB-style files is described here.)

Timeline for d1kf6b2: