Lineage for d1kf6a3 (1kf6 A:226-357)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198685Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)
  4. 198686Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) (S)
  5. 198687Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (4 proteins)
  6. 198716Protein Fumarate reductase flavoprotein subunit [56429] (2 species)
  7. 198717Species Escherichia coli [TaxId:562] [56430] (3 PDB entries)
  8. 198718Domain d1kf6a3: 1kf6 A:226-357 [72396]
    Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6b1, d1kf6b2, d1kf6c_, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6n1, d1kf6n2, d1kf6o_, d1kf6p_

Details for d1kf6a3

PDB Entry: 1kf6 (more details), 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO

SCOP Domain Sequences for d1kf6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf6a3 d.168.1.1 (A:226-357) Fumarate reductase flavoprotein subunit {Escherichia coli}
mefvqyhptglpgsgilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelg
prdkvsqafwhewrkgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvk
epipvrptahyt

SCOP Domain Coordinates for d1kf6a3:

Click to download the PDB-style file with coordinates for d1kf6a3.
(The format of our PDB-style files is described here.)

Timeline for d1kf6a3: