Lineage for d1kenu2 (1ken U:109-213)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289984Domain d1kenu2: 1ken U:109-213 [72386]
    Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenh2, d1kenl1, d1kent1, d1kent2, d1kenu1
    part of Fab against influenza virus hemagglutinin
    complexed with man, nag

Details for d1kenu2

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kenu2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kenu2 b.1.1.2 (U:109-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppskiqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1kenu2:

Click to download the PDB-style file with coordinates for d1kenu2.
(The format of our PDB-style files is described here.)

Timeline for d1kenu2: