Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
Domain d1kenu2: 1ken U:109-213 [72386] Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenh2, d1kenl1, d1kent1, d1kent2, d1kenu1 part of Fab against influenza virus hemagglutinin complexed with man, nag |
PDB Entry: 1ken (more details), 3.5 Å
SCOP Domain Sequences for d1kenu2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kenu2 b.1.1.2 (U:109-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppskiqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d1kenu2: