SCOP 1.71: Domain d1kent2: 1ken T:121-219

Lineage for d1kent2 (1ken T:121-219)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1kent2: 1ken T:121-219 [72384]
   Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenl1, d1kenl2, d1kent1, d1kenu1, d1kenu2
   part of Fab against influenza virus hemagglutinin
   complexed with man, nag

Details for d1kent2

PDB Entry: 1ken, 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kent2:

Sequence; same for both SEQRES and ATOM records:

>d1kent2 b.1.1.2 (T:121-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Timeline for d1kent2:

• d1kent2 first appeared in SCOP 1.61
  
• d1kent2 appears in SCOP 1.69
  
• d1kent2 appears in SCOP 1.73
  
• d1kent2 appears in the current release, SCOPe 2.08