Lineage for d1kenl1 (1ken L:1-108)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2354171Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (13 PDB entries)
  8. 2354186Domain d1kenl1: 1ken L:1-108 [72381]
    Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenh2, d1kenl2, d1kent1, d1kent2, d1kenu2
    part of Fab against influenza virus hemagglutinin

Details for d1kenl1

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition
PDB Compounds: (L:) influenza virus infectivity neutralizing antibody (light chain)

SCOPe Domain Sequences for d1kenl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kenl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
qivltqspaimsaspgekvtltcsasstitssflywyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissleaedgasyfchqwetfprtfgggtkleik

SCOPe Domain Coordinates for d1kenl1:

Click to download the PDB-style file with coordinates for d1kenl1.
(The format of our PDB-style files is described here.)

Timeline for d1kenl1: