Lineage for d1kenl1 (1ken L:1-108)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219555Species Fab against influenza virus hemagglutinin, (mouse), kappa L chain [74814] (1 PDB entry)
  8. 219557Domain d1kenl1: 1ken L:1-108 [72381]
    Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh2, d1kenl2, d1kent2, d1kenu2

Details for d1kenl1

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kenl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kenl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab against influenza virus hemagglutinin, (mouse), kappa L chain}
qivltqspaimsaspgekvtltcsasstitssflywyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissleaedgasyfchqwetfprtfgggtkleik

SCOP Domain Coordinates for d1kenl1:

Click to download the PDB-style file with coordinates for d1kenl1.
(The format of our PDB-style files is described here.)

Timeline for d1kenl1: