Lineage for d1kenh2 (1ken H:121-221)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655756Domain d1kenh2: 1ken H:121-221 [72380]
    Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenl1, d1kenl2, d1kent1, d1kenu1, d1kenu2

Details for d1kenh2

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition
PDB Compounds: (H:) influenza virus infectivity neutralizing antibody (heavy chain)

SCOP Domain Sequences for d1kenh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kenh2 b.1.1.2 (H:121-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1kenh2:

Click to download the PDB-style file with coordinates for d1kenh2.
(The format of our PDB-style files is described here.)

Timeline for d1kenh2: