Lineage for d1kenf_ (1ken F:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 345566Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
    core: trimeric coiled coil
  4. 345567Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 345568Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 345569Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 345570Species Influenza A virus, different strains [TaxId:11320] [58067] (24 PDB entries)
  8. 345625Domain d1kenf_: 1ken F: [72378]
    Other proteins in same PDB: d1kena_, d1kenc_, d1kene_, d1kenh1, d1kenh2, d1kenl1, d1kenl2, d1kent1, d1kent2, d1kenu1, d1kenu2
    complexed with man, nag

Details for d1kenf_

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kenf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kenf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d1kenf_:

Click to download the PDB-style file with coordinates for d1kenf_.
(The format of our PDB-style files is described here.)

Timeline for d1kenf_: