Lineage for d1kend_ (1ken D:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 895846Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 895847Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 895848Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 895849Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 895850Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 895959Domain d1kend_: 1ken D: [72376]
    Other proteins in same PDB: d1kena_, d1kenc_, d1kene_, d1kenh1, d1kenh2, d1kenl1, d1kenl2, d1kent1, d1kent2, d1kenu1, d1kenu2

Details for d1kend_

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition
PDB Compounds: (D:) hemagglutinin HA2

SCOP Domain Sequences for d1kend_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kend_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d1kend_:

Click to download the PDB-style file with coordinates for d1kend_.
(The format of our PDB-style files is described here.)

Timeline for d1kend_: